PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P11760_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 252aa    MW: 28673.3 Da    PI: 4.6318
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P11760_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.9e-1948101356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k+++++ +q+++Le+ Fe +++++ e++ +LA+ lgL+ rqV vWFqNrRa++k
  GSMUA_Achr7P11760_001  48 KKRRLSVDQVKALEKNFEVENKLDPERKVRLARDLGLQPRQVAVWFQNRRARWK 101
                            456899***********************************************9 PP

2HD-ZIP_I/II126.51.2e-4047139193
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrls +qvk+LE++Fe e+kL+perKv+lar+LglqprqvavWFqnrRAR+ktkqlE+dy aLk+ +d lk + ++L++++e L 
  GSMUA_Achr7P11760_001  47 EKKRRLSVDQVKALEKNFEVENKLDPERKVRLARDLGLQPRQVAVWFQNRRARWKTKQLERDYGALKSLHDDLKLDCDALRRDKELLL 134
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eelke 93 
                            +e++e
  GSMUA_Achr7P11760_001 135 AEIRE 139
                            99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.1E-1941105IPR009057Homeodomain-like
PROSITE profilePS5007116.98943103IPR001356Homeobox domain
SMARTSM003891.0E-1846107IPR001356Homeobox domain
PfamPF000461.5E-1648101IPR001356Homeobox domain
CDDcd000862.70E-1748104No hitNo description
Gene3DG3DSA:1.10.10.603.8E-2050110IPR009057Homeodomain-like
PRINTSPR000312.0E-57483IPR000047Helix-turn-helix motif
PROSITE patternPS00027078101IPR017970Homeobox, conserved site
PRINTSPR000312.0E-58399IPR000047Helix-turn-helix motif
PfamPF021832.5E-14103144IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MKQVRWRFVI QVEEKGKYEA VLVDGIEEVE CEEEEELCSN GPSGLGEKKR RLSVDQVKAL  60
EKNFEVENKL DPERKVRLAR DLGLQPRQVA VWFQNRRARW KTKQLERDYG ALKSLHDDLK  120
LDCDALRRDK ELLLAEIREL KAKLADTGMD ATQSEIIKAV EEARAPLIYK DGASDSDSSV  180
VFNDETSPYG GLVLHQNCLM EFKPRSSSLS FENKAMDEGF LGGDELCSSL FSEQPAPSLS  240
WYCSDPCEYK GD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195103RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009409169.11e-176PREDICTED: homeobox-leucine zipper protein HOX13-like
SwissprotA2YWC08e-57HOX20_ORYSI; Homeobox-leucine zipper protein HOX20
SwissprotQ6Z2488e-57HOX20_ORYSJ; Homeobox-leucine zipper protein HOX20
TrEMBLM0TGR40.0M0TGR4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P11760_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.14e-56homeobox protein 16